ImmunoGeNN accepts input protein sequences and predicts population-level immunogenicty risk scores (MHC-II) based on allele frequencies in the global population. It also supports deimmunization and immunization of the first input sequence by screening all single amino acid variants (SAVs) for predicted immunogenicity risk changes and sequence likelihood (ESM2). Read more in our EurIPS 2025 SIMBIOCHEM workshop paper.
Example FASTA input:
>LYZL4_MOUSE Lysozyme-like protein 4
MQLYLVLLLISYLLTPIGASILGRCTVAKMLYDGGLNYFEGYSLENWVCLAYFESKFNPS
AVYEDPQDGSTGFGLFQIRDNEWCGHGKNLCSVSCTALLNPNLKDTIQCAKKIVKGKHGM
GAWPIWSKNCQLSDVLDRWLDGCDL
Web-servers and code:
Download and install:
git clone https://github.com/novonordisk-research/ImmunoGeNN && cd ImmunoGeNN
# Unzip human reference data
unzip data_record.zip
# Install requirements
pip install -r requirements.txt
# Screen protein sequences for predicted immunogenicity risk in global population (pIRS)
python run.py --fasta_file \
data/input.fasta- Input FASTA - Input FASTA file of proteins sequences (minimum sequence length of 15 residues)
- Human reference filtering - Screens peptide (9mer) binding cores against the human proteome, and assings pIRS=0 if found.
- Extra references - Optionally, provide extra reference proteomes in FASTA format to screen against (e.g. known self-proteins)
Modes:
- Screening mode - Predicts pIRS scores for all input sequences
- Deimmunization mode - Screens all single amino acid variants (SAVs) in the specified ranges for the first input sequence for predicted pIRS. Generates FASTA and scores.csv file for the top n deimmunizing variants (sorted by ranked pIRS x ranked ESM2 likelihood^2)
- Immunization mode - Same as above, for variants increasing pIRS.
Deimmunize first sequence
# Optional: Install ESM2 requirements
# pip install -r requirements_esm.txt
python run.py \
--fasta_file data/input.fasta \
--mode deimmunizeImmunize first sequence
# Optional: Install ESM2 requirements
# pip install -r requirements_esm.txt
python run.py \
--fasta_file data/input.fasta \
--mode immunizeImmunoGeNN predicts per-peptide IRS scores ("pIRS") for the Global population, DRB1 gene class. Sequence pIRS_sum scores are calculated by summing across all peptide pIRS scores in the given sequence.
pIRS score interpretation: We suggest using a pIRS rank threshold of ~83% to identify immunogenic peptides, as described in the paper. Higher scores indicate higher global population (MHC-II presentation) immunogenicity risk, with an estimated experimental Spearman R MAPPs correlation of ~0.45.
pIRS.csv - CSV file containing per-peptide pIRS scores
id,peptide_pos,gene_class,peptide_seq,core_pos,core_seq,pIRS,pIRS_rank,in_reference,core_0,core_1,core_2,core_3,core_4,core_5,core_6
design1,1,DRB1,EVQLLESGGEVKKPG,3,LLESGGEVK,0.03498,44.949,,0.00,0.00,13.96,67.79,18.25,0.00,0.00
design1,2,DRB1,VQLLESGGEVKKPGA,3,LESGGEVKK,0.03122,36.630,,11.49,0.00,31.90,56.62,0.00,0.00,0.00
design1,3,DRB1,QLLESGGEVKKPGAS,2,LESGGEVKK,0.02773,20.586,,0.00,14.51,71.27,0.00,0.00,0.00,14.22- id: Sequence identifier from input FASTA
- peptide_pos: Position of peptide in sequence (1-indexed)
- gene_class: Always MHC-II DRB1 gene class
- peptide_seq: Peptide sequence
- core_pos: Position of dominant DRB1 binding core in peptide (0-indexed)
- core_seq: DRB1 binding core sequence
- pIRS: Predicted immunogenicity risk score. Higher is more immunogenic
- pIRS_rank: Predicted rank in NetMHCIIpan-4.3 training set (see paper). Higher is more immunogenic above a threshold of ~83%.
- in_reference: Set to True if the 9-mer core sequence is found in human reference proteome
- core_0 to core_6: Predicted peptide IRS for all 7 binding cores, corresponding to model confidence. The top binding core is picked based on the highest pIRS score. See paper for more details.
scores.csv - CSV file containing per-sequence pIRS scores (summed across all peptides)
id,population,DRB1_pIRS_sum
design1,Global,5.16455
design2,Global,5.17534
design3,Global,5.13089- id: Sequence identifier from input FASTA
- population: Population for which pIRS is calculated
- DRB1_pIRS_sum: Sum of pIRS scores across all peptides in the sequence
Visualizes the immunogenicity effect of peptide variants across the sequence:
Build Docker image:
docker build -t app-immunogenn .
Run Docker container:
docker run -v $(pwd)/data:/app/data -it app-immunogenn \
python run.py --fasta_file data/input.fasta
@inproceedings{
hoie2025_immunogenn,
title={ImmunoGe{NN}: Accelerating Early Immunogenicity Assessment for Generative Design of Biologics},
author={Magnus Haraldson H{\o}ie and Birkir Reynisson and Paolo Marcatili and Jesper Ferkinghoff-Borg and Kasper Lamberth and Katharina L. Kopp and Morten Nielsen and Vanessa Isabell Jurtz},
booktitle={EurIPS 2025 Workshop on SIMBIOCHEM},
year={2025},
url={https://openreview.net/forum?id=kOJQm9YXnB}
}This project is licensed under the MIT License - see the LICENSE file for details.


